PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo23G0003800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 396aa    MW: 44165.5 Da    PI: 6.7401
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo23G0003800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-182369148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd llv++vkq+G + W+ Ia+++  gR +kqc++rw+++l
  Spipo23G0003800 23 KGQWTAEEDRLLVQLVKQHGVKKWSQIAKKLL-GRIGKQCRERWHNHL 69
                     799****************************9.*************97 PP

2Myb_DNA-binding58.21.9e-1875117145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT++E+ llv+a+++ G++ W+ Ia++++ gRt++++k++w+
  Spipo23G0003800  75 KDVWTEDEERLLVEAHEKIGNR-WAEIAKMIP-GRTENSIKNHWN 117
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.4231873IPR017930Myb domain
SuperFamilySSF466895.75E-3220116IPR009057Homeodomain-like
SMARTSM007174.7E-182271IPR001005SANT/Myb domain
PfamPF002491.0E-162369IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-272476IPR009057Homeodomain-like
CDDcd001678.12E-172669No hitNo description
PROSITE profilePS5129420.32574124IPR017930Myb domain
SMARTSM007171.3E-1774122IPR001005SANT/Myb domain
PfamPF002494.6E-1775117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2177122IPR009057Homeodomain-like
CDDcd001678.85E-1478120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MVRKAREGRK PGSNAASDLN VVKGQWTAEE DRLLVQLVKQ HGVKKWSQIA KKLLGRIGKQ  60
CRERWHNHLR PDIKKDVWTE DEERLLVEAH EKIGNRWAEI AKMIPGRTEN SIKNHWNATK  120
RRQNSRRKPK KDELQCRRSP PSILQEYIRR KTLDDETLAP NAAVNPPITF SAATVVSPSD  180
LAASWNQLHS TLPALLDPAS GKAAPVSTTE LNFDEDVLTV EDFFMESGGI TMAEETYVGV  240
EAYSYGPPVN KSSDIYDYDE ISQFLDVGHC GILTSPEEES YETVVNPDGV DGPVHNNLIV  300
GCSINGTREN SIARCLSSDM YLSHLFDGGF STSSTEVDQG SVPKVSLSKN TEASSAWSLN  360
RGYKGDLDLI EMICSTQFSK RKSSRNSQDH LHRIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-45211232104C-Myb DNA-Binding Domain
1mse_C5e-45211232104C-Myb DNA-Binding Domain
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.12e-63myb domain protein 64